KDM4B anticorps (Middle Region)

N° du produit ABIN631296

Cet anticorps anti-KDM4B est un anticorps Lapin Polyclonal détectant KDM4B dans WB. Adapté pour Humain.

Aperçu rapide pour KDM4B anticorps (Middle Region) (ABIN631296)

Antigène: KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KDM4B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KDM4B anticorps

Épitope: Middle Region

Specificité: JMJD2 B antibody was raised against the middle region of JMJD2

Purification: Affinity purified

Immunogène: JMJD2 B antibody was raised using the middle region of JMJD2 corresponding to a region with amino acids DQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

JMJD2B Blocking Peptide, (ABIN937510), is also available for use as a blocking control in assays to test for specificity of this JMJD2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JMJD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KDM4B

Antigène: KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))

Autre désignation: JMJD2B

Sujet: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes.

Poids moléculaire: 122 kDa (MW of target protein)

Pathways: L'effet Warburg